PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629541.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 860aa    MW: 96333.3 Da    PI: 5.7003
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629541.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.47.9e-193682148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEde+l++av+ + g++Wk+Ia+++   Rt+ qc +rwqk+l
   XP_013629541.1 36 RGQWTAEEDEILKKAVHNFKGKNWKKIAEYFK-DRTDVQCLHRWQKVL 82
                     89*****************************9.************986 PP

2Myb_DNA-binding63.15.7e-2088134148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd+ +v++++++G++ W+tIar+++ gR +kqc++rw+++l
   XP_013629541.1  88 KGPWTKEEDDMIVQLIQKYGPKKWSTIARYLP-GRIGKQCRERWHNHL 134
                      79******************************.*************97 PP

3Myb_DNA-binding42.21.9e-13140182145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gR+++ +k++w+
   XP_013629541.1 140 KEAWTQEEELVLIRAHQVYGNR-WAELTKFLP-GRSDNGIKNHWH 182
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1523182IPR017930Myb domain
SuperFamilySSF466891.65E-183496IPR009057Homeodomain-like
SMARTSM007172.2E-153584IPR001005SANT/Myb domain
PfamPF002491.5E-163682IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-243897IPR009057Homeodomain-like
CDDcd001678.05E-143982No hitNo description
PROSITE profilePS5129432.27483138IPR017930Myb domain
SuperFamilySSF466892.92E-3185181IPR009057Homeodomain-like
SMARTSM007174.9E-1987136IPR001005SANT/Myb domain
PfamPF002494.2E-1888134IPR001005SANT/Myb domain
CDDcd001671.82E-1690134No hitNo description
Gene3DG3DSA:1.10.10.606.0E-2798142IPR009057Homeodomain-like
SMARTSM007174.0E-12139187IPR001005SANT/Myb domain
PROSITE profilePS5129417.977139189IPR017930Myb domain
PfamPF002491.6E-11140182IPR001005SANT/Myb domain
CDDcd001672.53E-9142182No hitNo description
Gene3DG3DSA:1.10.10.601.2E-19143189IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 860 aa     Download sequence    Send to blast
MESECATTPP PDGLTEGNPS KSRQGRTSGP TRRSTRGQWT AEEDEILKKA VHNFKGKNWK  60
KIAEYFKDRT DVQCLHRWQK VLNPELVKGP WTKEEDDMIV QLIQKYGPKK WSTIARYLPG  120
RIGKQCRERW HNHLNPAINK EAWTQEEELV LIRAHQVYGN RWAELTKFLP GRSDNGIKNH  180
WHSSVKKKLD SYMSSGLLDQ YQAMPLAPYE RSSTLQSIDG NGCVSGQAGK EVENCQISTL  240
ASCSISAMDY QNGMINMEHH FHPCGNSHKN EYYYPELEDI SVSISELSYE MEDCSQFPDH  300
NVSSQDCHFD FQELSDISLE MRHSMSELPM PYAKESKEAS LGGPNSTSNT DVATYTNTAN  360
VSETECCRVL FVDQESEGLS VSRSSTQEPN EVSSTKSPMQ TSSSKSIATA ASGKETLRPA  420
PLIISPDKYS KKSSGLICHP FEAEPNSRTN ENGGFICIDG PSSAPNNSSE EDQSYHLNDS  480
KKLVPVNDFT SLTEVKPHSL PKHEPMEQHH EDTEASSSSL SFPSLDLPVF NSDLLQSKND  540
PLHDYSPLGI RKLLMSTMTC MSPLRLWESP TGKKTLVGAK SILRKRTRDL LTPLSEKRSD  600
KKLEIDIAAS LSKDFSRLDV MFDEIESRED SMSLEKPEQS CLDASVKEKG VENVESLSGV  660
LSENNNTNKQ VLSPPSQSVT KTEKAQVSTP RNHLHSSASL CLVINSPSRA RNTEGHHVDN  720
ETRNENFSIF CGTPFRRGLE SPSAWKSPFY VNSLLHSPRF DTDITIEDMG YIFSPGERSY  780
GSIGLMTQRN ELTSAFAAFD AMEVSLSASN YDDARKMKEL DKENNDPLLA ERRVLDFNDC  840
ESPTKVTEEA SSSYLLKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-69361896159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-69361896159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2324500.0AC232450.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010H02, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629541.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_013653801.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_013661875.10.0PREDICTED: myb-related protein 3R-1-like
SwissprotQ9S7G71e-156MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0D3B0M30.0A0A0D3B0M3_BRAOL; Uncharacterized protein
STRINGBra006102.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4